PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PDK_30s1179691g001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Coryphoideae; Phoeniceae; Phoenix
Family NAC
Protein Properties Length: 310aa    MW: 35017.3 Da    PI: 8.1973
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PDK_30s1179691g001genomePDKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM170.84.2e-5351311128
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdk 90 
                         lppGfrFhPtdeel+ +yL +kv++ ++ + ++i+evd+ k+ePw+Lp k+   +ekewyfFs rd+ky+tg r+nrat++gyWk+tgkd+
  PDK_30s1179691g001   5 LPPGFRFHPTDEELIICYLSRKVSDFRFFT-KAIAEVDLKKCEPWELPgKANFMGEKEWYFFSLRDRKYPTGLRTNRATDAGYWKTTGKDR 94 
                         79*************************888.88***************544445889********************************** PP

                 NAM  91 evlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                         e+++ +g lvg+kktLvfykgrap+gekt W mheyrl
  PDK_30s1179691g001  95 EIFH-SGILVGMKKTLVFYKGRAPNGEKTGWAMHEYRL 131
                         ****.99*****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.49E-624151IPR003441NAC domain
PROSITE profilePS5100558.6125152IPR003441NAC domain
PfamPF023658.4E-276131IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 310 aa     Download sequence    Send to blast
MEGNLPPGFR FHPTDEELII CYLSRKVSDF RFFTKAIAEV DLKKCEPWEL PGKANFMGEK  60
EWYFFSLRDR KYPTGLRTNR ATDAGYWKTT GKDREIFHSG ILVGMKKTLV FYKGRAPNGE  120
KTGWAMHEYR LHTKFPYKST KEEWVVCRVF RRVSSGKKLQ EGTSSMPQSF GSPCNTTSGT  180
ELGEPNTSIL DNLINPSSTL DPVLINNDND NNSNWGFAKE TTNQIMQCAW PSGLLSSSFS  240
ADPGILKALQ LNNKQSREAT DVTTSNHFIA QGDTVFGDES SLSFPASSSR GMDSMQQQQL  300
FDQNSIWKGY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B2e-55415816171NAC domain-containing protein 19
4dul_A2e-55415816171NAC domain-containing protein 19
1ut7_B2e-55415816171NO APICAL MERISTEM PROTEIN
1ut7_A2e-55415816171NO APICAL MERISTEM PROTEIN
1ut4_B2e-55415816171NO APICAL MERISTEM PROTEIN
1ut4_A2e-55415816171NO APICAL MERISTEM PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008799244.10.0PREDICTED: protein CUP-SHAPED COTYLEDON 2-like
TrEMBLB9IE381e-116B9IE38_POPTR; Uncharacterized protein
STRINGPOPTR_0015s03700.11e-116(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP79193450
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18400.12e-94NAC domain containing protein 58